Information
Organism Papilio xuthus
Gene ID PxuthusGene0012351
Scaffold scaffold523
Position 105..2304 [Map]
Strand +
Gene symbol/function D2A134_TRICA Putative uncharacterized protein GLEAN_08318
Ortholog in PapilioBase PpolytesGene0008542
Ortholog in silkworm BMgn009999
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MALYEGIALIQEKQAVVLDLGTDYTKFGFTGEAAPRCIVRSEFWCPAERRYKRLHDYSSPQELYDNIVHMLHLLYFRHVL
    VNPKERRVVVVESLLTPTLFRETLAKVLFIHYEVSGALWVDSGRASALTLAAPVVLVVSIGARDAEVTAVVHGCPVLRAL
    QSQPLGARAVSAELARLLDEDNGRALNLPDDVLDDIKVRACFVPGREAALQWAARGVPAEVREARRGADAVVSRRARALS
    AEPLFARDEELASLPDMVLQCIAQCPIDARRALAASVLVTGGGAALPGLRARLAQELRHLAKLPPYKYVPPRLLLF

    CDS
    ATGGCGCTCTACGAAGGCATTGCTCTTATTCAAGAAAAACAAGCAGTCGTCTTGGATCTTGGCACGGACTACACTAAGTT
    TGGGTTCACGGGCGAGGCGGCGCCGCGCTGCATCGTTCGCTCAGAGTTCTGGTGCCCAGCGGAGCGCCGGTACAAGCGAC
    TGCACGACTACAGCTCACCACAGGAACTCTATGACAATATTGTTCATATGCTCCATTTGTTATATTTTAGGCATGTCCTG
    GTGAACCCAAAAGAGCGCCGCGTAGTGGTGGTGGAGTCCCTGCTCACGCCCACGCTCTTCCGGGAGACCCTCGCCAAAGT
    CCTCTTTATACATTACGAGGTGTCGGGCGCGCTGTGGGTGGACAGTGGGCGGGCGAGCGCGCTCACGCTGGCCGCGCCCG
    TCGTGCTCGTCGTCTCCATAGGAGCGCGCGACGCGGAGGTCACTGCAGTGGTGCACGGGTGCCCGGTGCTGCGCGCGCTG
    CAGTCCCAGCCGCTGGGCGCGCGGGCGGTCAGCGCGGAGCTGGCGCGTCTGCTGGACGAGGACAACGGCCGCGCGCTCAA
    CTTGCCCGACGACGTCCTCGATGACATTAAAGTGCGCGCGTGCTTCGTGCCGGGACGCGAGGCGGCGCTGCAGTGGGCGG
    CGCGCGGCGTGCCCGCGGAGGTGCGGGAGGCGCGGCGCGGGGCCGACGCGGTGGTGTCGCGGCGAGCGCGCGCGCTGTCC
    GCGGAGCCGCTGTTCGCGCGGGACGAGGAGCTCGCCTCCCTGCCCGACATGGTGCTGCAGTGCATCGCGCAGTGCCCGAT
    AGACGCGCGGCGAGCGCTGGCCGCCTCCGTGCTGGTGACAGGGGGCGGCGCCGCGCTGCCGGGCCTGCGCGCGCGCCTCG
    CCCAGGAGCTGCGCCACCTCGCCAAGCTGCCGCCCTACAAGTACGTTCCGCCGCGACTCTTACTTTTCTAA

    Transcriptome
    CTTATGTATGTCGTCTGTCACAGTCGCTCGCCAGTCGTTGAAGTTATAATAATAACAAAATTTTACCAATAAACTTTGTT
    TTTAACAGTTTCAATTTAAAGAGGAAATGCCATCAAATTTCTGAACAAAGTTGAAATCGTATCACAAAGTCATGGCGCTC
    TACGAAGGCATTGCTCTTATTCAAGAAAAACAAGCAGTCGTCTTGGATCTTGGCACGGACTACACTAAGTTTGGGTTCAC
    GGGCGAGGCGGCGCCGCGCTGCATCGTTCGCTCAGAGTTCTGGTGCCCAGCGGAGCGCCGGTACAAGCGACTGCACGACT
    ACAGCTCACCACAGGAACTCTATGACAATATTGTTCATATGCTCCATTTGTTATATTTTAGGCATGTCCTGGTGAACCCA
    AAAGAGCGCCGCGTAGTGGTGGTGGAGTCCCTGCTCACGCCCACGCTCTTCCGGGAGACCCTCGCCAAAGTCCTCTTTAT
    ACATTACGAGGTGTCGGGCGCGCTGTGGGTGGACAGTGGGCGGGCGAGCGCGCTCACGCTGGCCGCGCCCGTCGTGCTCG
    TCGTCTCCATAGGAGCGCGCGACGCGGAGGTCACTGCAGTGGTGCACGGGTGCCCGGTGCTGCGCGCGCTGCAGTCCCAG
    CCGCTGGGCGCGCGGGCGGTCAGCGCGGAGCTGGCGCGTCTGCTGGACGAGGACAACGGCCGCGCGCTCAACTTGCCCGA
    CGACGTCCTCGATGACATTAAAGTGCGCGCGTGCTTCGTGCCGGGACGCGAGGCGGCGCTGCAGTGGGCGGCGCGCGGCG
    TGCCCGCGGAGGTGCGGGAGGCGCGGCGCGGGGCCGACGCGGTGGTGTCGCGGCGAGCGCGCGCGCTGTCCGCGGAGCCG
    CTGTTCGCGCGGGACGAGGAGCTCGCCTCCCTGCCCGACATGGTGCTGCAGTGCATCGCGCAGTGCCCGATAGACGCGCG
    GCGAGCGCTGGCCGCCTCCGTGCTGGTGACAGGGGGCGGCGCCGCGCTGCCGGGCCTGCGCGCGCGCCTCGCCCAGGAGC
    TGCGCCACCTCGCCAAGCTGCCGCCCTACAAGTACGTTCCGCCGCGACTCTTACTTTTCTAACTGAAACGCTTCACTCTC
    GAACGGTCGTGTGCGACGTGTTGCAGAGAGCGGCTGCAGGAGCTGCAGTTCAAGTTCCACTCTGCGCCGGCGCACGAGAA
    CAGCGTGGCGTGGGTGGGCG