Information
Organism Papilio xuthus
Gene ID PxuthusGene0011434
Scaffold scaffold4590
Position 394..833 [Map]
Strand +
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MVREPGAWEEPDFRDTYRPPRERNNTDSRFERRSFTRDSFSSDMKRDRDRDRDRDRDRDERYISDKPRDREENRRSGGRY
    SQRRYDKEEEEPEW

    CDS
    ATGGTGCGCGAGCCGGGCGCCTGGGAGGAGCCGGACTTCCGCGACACGTACCGCCCCCCCAGGGAGCGCAACAACACCGA
    CAGCAGGTTCGAGCGGCGGTCGTTCACGCGCGACTCCTTCTCATCCGACATGAAGCGAGACCGCGACCGTGACCGTGACC
    GTGACCGAGATCGCGACGAGCGCTACATCAGCGACAAGCCGCGGGATAGAGAGGAGAACCGGCGGTCGGGCGGACGCTAC
    TCGCAGCGCCGCTACGACAAGGAGGAGGAGGAGCCCGAGTGGTGA

    Transcriptome
    ATGGTGCGCGAGCCGGGCGCCTGGGAGGAGCCGGACTTCCGCGACACGTACCGCCCCCCCAGGGAGCGCAACAACACCGA
    CAGCAGGTTCGAGCGGCGGTCGTTCACGCGCGACTCCTTCTCATCCGACATGAAGCGAGACCGCGACCGTGACCGTGACC
    GTGACCGAGATCGCGACGAGCGCTACATCAGCGACAAGCCGCGGGATAGAGAGGAGAACCGGCGGTCGGGCGGACGCTAC
    TCGCAGCGCCGCTACGACAAGGAGGAGGAGGAGCCCGAGTGGTGA