Information
Organism Papilio xuthus
Gene ID PxuthusGene0009473
Scaffold scaffold3665
Position 42153..42473 [Map]
Strand +
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MLKQIIHKGQTYKTKSNRRKVVKTVTGKYKNIKQKKHSKVRRCHECNAKLLSIARMRPAELSRQKVSSKRVCRPYGDKFC
    GNCVRNRVISAFLEEEERIVREKLAV

    CDS
    ATGTTAAAACAAATTATTCACAAAGGACAAACTTACAAGACTAAAAGTAACAGAAGAAAGGTAGTAAAGACTGTAACTGG
    TAAATACAAGAATATTAAACAGAAAAAACATTCTAAAGTAAGAAGATGTCATGAATGTAATGCTAAACTTCTTTCTATTG
    CTAGAATGAGACCAGCTGAATTATCAAGACAGAAAGTGTCTTCTAAAAGGGTTTGTAGACCATACGGAGATAAATTTTGT
    GGAAACTGTGTAAGAAATAGAGTAATTAGTGCTTTCTTAGAAGAAGAGGAGAGGATTGTACGAGAAAAATTGGCAGTTTA
    A

    Transcriptome
    ATGTTAAAACAAATTATTCACAAAGGACAAACTTACAAGACTAAAAGTAACAGAAGAAAGGTAGTAAAGACTGTAACTGG
    TAAATACAAGAATATTAAACAGAAAAAACATTCTAAAGTAAGAAGATGTCATGAATGTAATGCTAAACTTCTTTCTATTG
    CTAGAATGAGACCAGCTGAATTATCAAGACAGAAAGTGTCTTCTAAAAGGGTTTGTAGACCATACGGAGATAAATTTTGT
    GGAAACTGTGTAAGAAATAGAGTAATTAGTGCTTTCTTAGAAGAAGAGGAGAGGATTGTACGAGAAAAATTGGCAGTTTA
    A