Information
Organism Papilio xuthus
Gene ID PxuthusGene0005875
Scaffold scaffold3067
Position 46431..49514 [Map]
Strand +
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MFDSNLSTVEIEKKILEYWKDNDCFNKSNVLSKDREKFTFYDGPPFATGLPHYGHILSGTIKDVVTRYKYQHGYHVDRRF
    GWDCHGLPVEYEIDKTHNITSRDQVLEMGIDKYNDLCKSIVMKYSSEWKVTVEQMGRWVDFDNGYKTMDKGFMDSVWFIF
    KQLFDKKYVYRGYKVMPFSTGCMTPLSNFEANQNYKNTLDPSIVVSFELKEDFEGHRVSMLVWTTTPWTLPSNCGLVINE
    SFTYVLFEVNGKRYIIGKTRIEEYFKDVKIIKEISGKDLVGLEYLQPFNYFEHLRKFGYFRIYAGDFVTDSDGTGIVHCS
    PGFGEDDYNVFVKHGLIKRNDLVPCPVDENGKFTKEISDFEGLYIKKADPLILKALGDKLIINGKKHHNYPYCWRSETPL
    IYKLVPNWFIRVTDSVDKLLANNEKINWVPEDIKYKKFHNWLADVKDWSFSRNRFWGTPIPLWTNEDFSVIYCIESAEEL
    EKLSGKKITDIHRQFIDDIEIVVDGVTLKRIPEVFDCWFESGSMPYAQNNWPFCLKDKFKMNEIKEEITTKEECSPKDTI
    YNDMVLKNFPADFIAEGIDQTRGWFYSLHVISTLLFNKPAFKNVVVNGIVKADDGEKMSKSKKNYPSPDLILNEFGADSL
    RSYLISSPVVEGQDLKFKKEGVKEIQKTLIIPWMNSLLFCTTSKSTEPEELVLDNWIKNSFNVFLSKVEDSMNKYELSKV
    ISYALQFIDDLSNWYIRIHRKEIKDGNSAVLRELLEGFSIVMAPFTPFFSEYSYQTTSKGESVHFEMYPKKFETQEDTFE
    SAKELIEAIRSVREQKKINLKTPICEATVYCSLEFRNRLDRYLETISKECNVLKISFKDEDAISVTLKAKPYFENLKKDM
    KTMKKKMNIISKFTEKDIENILQRDLEYEGFVIKKDDIMIVKELTSDKDGLSKVCNSFILTLNNTLTKEVLELRDAREFN
    SFIQQLRKKLGLKSEDDVYIDIQSDYFKEVCSKHFNIVFGIEGEKVGEEQYKEGNEYKVTVYQKKNN

    CDS
    ATGTTTGATAGCAATTTAAGCACAGTTGAAATAGAAAAGAAGATTCTTGAATATTGGAAAGATAATGATTGTTTTAATAA
    AAGTAATGTTCTTAGTAAAGATAGGGAAAAATTTACTTTCTATGATGGACCACCATTCGCTACTGGATTACCACACTATG
    GCCATATTTTAAGTGGTACAATTAAAGACGTTGTAACTCGTTACAAGTATCAACACGGTTATCACGTGGATAGAAGGTTC
    GGTTGGGATTGTCATGGTCTTCCTGTTGAGTACGAAATAGATAAGACTCATAACATTACTAGTAGAGATCAAGTACTTGA
    AATGGGAATTGATAAATACAATGATTTGTGTAAATCTATCGTTATGAAATATAGTTCAGAATGGAAAGTAACAGTAGAGC
    AAATGGGAAGATGGGTTGATTTTGATAACGGTTATAAAACTATGGATAAGGGATTTATGGATAGTGTTTGGTTTATTTTT
    AAACAATTATTTGATAAGAAATACGTCTATAGAGGATATAAAGTCATGCCTTTCTCTACTGGTTGTATGACTCCTCTTAG
    TAATTTTGAAGCTAATCAGAATTATAAAAACACTCTTGATCCGTCTATAGTTGTATCTTTTGAATTAAAAGAAGATTTTG
    AAGGACATCGTGTCTCTATGCTCGTATGGACAACTACTCCTTGGACTCTTCCTTCAAATTGTGGTCTTGTTATTAATGAA
    AGTTTTACCTACGTCCTTTTTGAAGTTAATGGTAAGAGATATATAATAGGCAAAACTCGTATCGAAGAATACTTTAAAGA
    TGTTAAAATTATAAAGGAGATATCTGGTAAAGATTTAGTAGGACTAGAATATTTACAGCCTTTTAACTATTTTGAACACT
    TAAGAAAATTCGGTTATTTCAGAATTTACGCTGGAGATTTCGTTACTGATAGTGATGGTACTGGTATCGTGCATTGCTCT
    CCTGGTTTTGGTGAAGATGATTATAATGTTTTTGTAAAACACGGTCTTATAAAGAGAAATGATCTTGTTCCGTGTCCTGT
    AGATGAAAACGGAAAATTTACTAAAGAAATTTCTGATTTTGAAGGTTTATACATCAAGAAAGCAGATCCTTTGATATTAA
    AAGCACTTGGTGATAAATTAATAATTAATGGAAAGAAACACCATAACTATCCGTACTGCTGGAGATCAGAAACACCTCTT
    ATATATAAACTAGTACCGAATTGGTTTATTCGTGTCACTGATAGTGTTGATAAGCTCTTGGCCAATAATGAAAAAATTAA
    TTGGGTTCCTGAAGACATAAAATACAAGAAATTCCATAACTGGTTAGCCGATGTTAAAGATTGGTCTTTTTCAAGAAACA
    GATTTTGGGGCACACCAATTCCCCTGTGGACAAATGAAGATTTTTCGGTCATTTACTGTATTGAATCTGCTGAAGAATTA
    GAAAAATTAAGTGGCAAAAAAATAACGGACATTCATAGACAATTTATTGATGATATTGAAATAGTTGTTGATGGTGTGAC
    TTTAAAAAGAATTCCTGAAGTATTTGATTGTTGGTTTGAGAGTGGCAGTATGCCTTATGCGCAAAATAATTGGCCATTTT
    GCCTTAAAGATAAATTTAAAATGAATGAGATTAAAGAAGAAATTACAACAAAGGAAGAATGTTCTCCTAAAGATACAATT
    TATAATGATATGGTTTTAAAGAATTTCCCTGCTGATTTTATAGCTGAAGGTATTGATCAAACACGAGGATGGTTCTATAG
    TCTTCATGTCATCTCTACTTTGCTCTTTAATAAACCAGCCTTTAAGAACGTGGTTGTTAATGGTATTGTTAAAGCAGATG
    ATGGTGAGAAAATGAGTAAAAGTAAGAAGAATTATCCTAGTCCCGATTTGATTTTAAATGAGTTTGGTGCTGACAGTCTT
    AGATCTTACTTAATTTCTAGTCCAGTAGTTGAAGGACAGGATCTTAAATTTAAAAAGGAAGGTGTTAAAGAAATACAAAA
    GACTCTTATAATTCCTTGGATGAACTCTCTTTTATTTTGTACAACATCTAAATCCACTGAACCAGAAGAATTAGTTTTAG
    ACAATTGGATTAAGAACTCATTTAATGTTTTCTTAAGTAAAGTAGAAGACTCTATGAATAAGTACGAATTATCTAAAGTA
    ATAAGCTATGCTTTACAATTTATTGATGATTTATCTAATTGGTATATCAGGATTCATAGGAAAGAAATAAAAGATGGTAA
    TAGTGCCGTATTAAGAGAGTTATTAGAAGGCTTTAGCATAGTAATGGCACCTTTTACTCCTTTCTTCAGTGAATACAGTT
    ATCAAACGACTAGTAAAGGCGAAAGTGTTCATTTTGAAATGTATCCGAAGAAATTCGAAACGCAAGAAGATACTTTTGAA
    AGTGCTAAGGAGCTAATTGAAGCTATTAGATCAGTAAGAGAACAGAAAAAAATAAATCTTAAAACTCCAATTTGTGAGGC
    AACCGTCTACTGTTCACTTGAATTCAGGAACAGATTAGATAGATATCTCGAAACAATTTCAAAGGAATGTAATGTTCTTA
    AGATATCTTTTAAAGATGAAGACGCCATTTCTGTTACTCTTAAGGCCAAGCCGTACTTTGAGAATCTTAAAAAAGATATG
    AAAACAATGAAAAAGAAAATGAATATCATCAGTAAATTTACAGAGAAAGACATTGAAAATATCTTACAGAGAGATCTTGA
    ATACGAAGGCTTCGTTATTAAGAAAGATGATATTATGATAGTTAAAGAATTGACTTCTGATAAGGACGGGCTTTCAAAGG
    TTTGTAATTCGTTTATTCTGACCTTAAACAACACTCTTACTAAAGAAGTTTTGGAATTAAGAGATGCCAGAGAATTTAAT
    AGCTTTATTCAACAATTAAGAAAGAAACTTGGATTGAAATCAGAAGACGATGTCTATATTGATATTCAAAGTGATTACTT
    TAAGGAAGTCTGCTCTAAACATTTTAATATTGTTTTTGGAATTGAAGGAGAAAAAGTGGGTGAAGAACAGTATAAAGAAG
    GTAATGAATACAAGGTAACTGTTTACCAAAAGAAAAATAATTAA

    Transcriptome
    ATGTTTGATAGCAATTTAAGCACAGTTGAAATAGAAAAGAAGATTCTTGAATATTGGAAAGATAATGATTGTTTTAATAA
    AAGTAATGTTCTTAGTAAAGATAGGGAAAAATTTACTTTCTATGATGGACCACCATTCGCTACTGGATTACCACACTATG
    GCCATATTTTAAGTGGTACAATTAAAGACGTTGTAACTCGTTACAAGTATCAACACGGTTATCACGTGGATAGAAGGTTC
    GGTTGGGATTGTCATGGTCTTCCTGTTGAGTACGAAATAGATAAGACTCATAACATTACTAGTAGAGATCAAGTACTTGA
    AATGGGAATTGATAAATACAATGATTTGTGTAAATCTATCGTTATGAAATATAGTTCAGAATGGAAAGTAACAGTAGAGC
    AAATGGGAAGATGGGTTGATTTTGATAACGGTTATAAAACTATGGATAAGGGATTTATGGATAGTGTTTGGTTTATTTTT
    AAACAATTATTTGATAAGAAATACGTCTATAGAGGATATAAAGTCATGCCTTTCTCTACTGGTTGTATGACTCCTCTTAG
    TAATTTTGAAGCTAATCAGAATTATAAAAACACTCTTGATCCGTCTATAGTTGTATCTTTTGAATTAAAAGAAGATTTTG
    AAGGACATCGTGTCTCTATGCTCGTATGGACAACTACTCCTTGGACTCTTCCTTCAAATTGTGGTCTTGTTATTAATGAA
    AGTTTTACCTACGTCCTTTTTGAAGTTAATGGTAAGAGATATATAATAGGCAAAACTCGTATCGAAGAATACTTTAAAGA
    TGTTAAAATTATAAAGGAGATATCTGGTAAAGATTTAGTAGGACTAGAATATTTACAGCCTTTTAACTATTTTGAACACT
    TAAGAAAATTCGGTTATTTCAGAATTTACGCTGGAGATTTCGTTACTGATAGTGATGGTACTGGTATCGTGCATTGCTCT
    CCTGGTTTTGGTGAAGATGATTATAATGTTTTTGTAAAACACGGTCTTATAAAGAGAAATGATCTTGTTCCGTGTCCTGT
    AGATGAAAACGGAAAATTTACTAAAGAAATTTCTGATTTTGAAGGTTTATACATCAAGAAAGCAGATCCTTTGATATTAA
    AAGCACTTGGTGATAAATTAATAATTAATGGAAAGAAACACCATAACTATCCGTACTGCTGGAGATCAGAAACACCTCTT
    ATATATAAACTAGTACCGAATTGGTTTATTCGTGTCACTGATAGTGTTGATAAGCTCTTGGCCAATAATGAAAAAATTAA
    TTGGGTTCCTGAAGACATAAAATACAAGAAATTCCATAACTGGTTAGCCGATGTTAAAGATTGGTCTTTTTCAAGAAACA
    GATTTTGGGGCACACCAATTCCCCTGTGGACAAATGAAGATTTTTCGGTCATTTACTGTATTGAATCTGCTGAAGAATTA
    GAAAAATTAAGTGGCAAAAAAATAACGGACATTCATAGACAATTTATTGATGATATTGAAATAGTTGTTGATGGTGTGAC
    TTTAAAAAGAATTCCTGAAGTATTTGATTGTTGGTTTGAGAGTGGCAGTATGCCTTATGCGCAAAATAATTGGCCATTTT
    GCCTTAAAGATAAATTTAAAATGAATGAGATTAAAGAAGAAATTACAACAAAGGAAGAATGTTCTCCTAAAGATACAATT
    TATAATGATATGGTTTTAAAGAATTTCCCTGCTGATTTTATAGCTGAAGGTATTGATCAAACACGAGGATGGTTCTATAG
    TCTTCATGTCATCTCTACTTTGCTCTTTAATAAACCAGCCTTTAAGAACGTGGTTGTTAATGGTATTGTTAAAGCAGATG
    ATGGTGAGAAAATGAGTAAAAGTAAGAAGAATTATCCTAGTCCCGATTTGATTTTAAATGAGTTTGGTGCTGACAGTCTT
    AGATCTTACTTAATTTCTAGTCCAGTAGTTGAAGGACAGGATCTTAAATTTAAAAAGGAAGGTGTTAAAGAAATACAAAA
    GACTCTTATAATTCCTTGGATGAACTCTCTTTTATTTTGTACAACATCTAAATCCACTGAACCAGAAGAATTAGTTTTAG
    ACAATTGGATTAAGAACTCATTTAATGTTTTCTTAAGTAAAGTAGAAGACTCTATGAATAAGTACGAATTATCTAAAGTA
    ATAAGCTATGCTTTACAATTTATTGATGATTTATCTAATTGGTATATCAGGATTCATAGGAAAGAAATAAAAGATGGTAA
    TAGTGCCGTATTAAGAGAGTTATTAGAAGGCTTTAGCATAGTAATGGCACCTTTTACTCCTTTCTTCAGTGAATACAGTT
    ATCAAACGACTAGTAAAGGCGAAAGTGTTCATTTTGAAATGTATCCGAAGAAATTCGAAACGCAAGAAGATACTTTTGAA
    AGTGCTAAGGAGCTAATTGAAGCTATTAGATCAGTAAGAGAACAGAAAAAAATAAATCTTAAAACTCCAATTTGTGAGGC
    AACCGTCTACTGTTCACTTGAATTCAGGAACAGATTAGATAGATATCTCGAAACAATTTCAAAGGAATGTAATGTTCTTA
    AGATATCTTTTAAAGATGAAGACGCCATTTCTGTTACTCTTAAGGCCAAGCCGTACTTTGAGAATCTTAAAAAAGATATG
    AAAACAATGAAAAAGAAAATGAATATCATCAGTAAATTTACAGAGAAAGACATTGAAAATATCTTACAGAGAGATCTTGA
    ATACGAAGGCTTCGTTATTAAGAAAGATGATATTATGATAGTTAAAGAATTGACTTCTGATAAGGACGGGCTTTCAAAGG
    TTTGTAATTCGTTTATTCTGACCTTAAACAACACTCTTACTAAAGAAGTTTTGGAATTAAGAGATGCCAGAGAATTTAAT
    AGCTTTATTCAACAATTAAGAAAGAAACTTGGATTGAAATCAGAAGACGATGTCTATATTGATATTCAAAGTGATTACTT
    TAAGGAAGTCTGCTCTAAACATTTTAATATTGTTTTTGGAATTGAAGGAGAAAAAGTGGGTGAAGAACAGTATAAAGAAG
    GTAATGAATACAAGGTAACTGTTTACCAAAAGAAAAATAATTAA