Information
Organism Papilio xuthus
Gene ID PxuthusGene0005872
Scaffold scaffold3067
Position 21680..23236 [Map]
Strand -
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MSKDQKHFPVKALIRIRPGNNFLEYTDKIVKIEKENGIVSEFHFDKVLGPNATQNQVFKSIKEELIRFREGYNTTIFCYG
    NTGAGKTHTMIGNNKQQGLIYNVIGELLKELHNGKGNDGSKNGNAKGNDDMRINNDKEFNHNRINDDMRINNQTNDNDVG
    THSPFLSISYLEIYNEKVYDLLDPKEVNLRESNGVILVPGLSTKKIFNLKDFDSVFKKGLENRTTGETKLNQFSSRSHSI
    LRIQRGDVKLHLIDLAGSENNRKTGNEGVRLTESSNINRSLFVLAKVVNSIINKEIRIPYRDSKLTRLLQDSLGGNSICC
    IIANINDDESCIGDTINTLMFATKSKKIINKSGNKNEIGKVGDVKMGDGRVVGGNKMDNKRAMEFEEAGKLKEALDDYKT
    IQKFNESQFVESKIENLINQLKNNKKKVK

    CDS
    ATGTCAAAAGACCAAAAACATTTTCCTGTTAAAGCTTTAATCCGAATAAGACCTGGTAATAATTTCCTTGAGTATACAGA
    TAAAATAGTAAAAATAGAAAAAGAAAATGGTATTGTTTCTGAATTCCATTTTGATAAAGTTTTGGGTCCTAATGCCACTC
    AAAACCAGGTCTTTAAAAGCATAAAAGAAGAATTAATTCGGTTTAGAGAAGGGTATAATACTACAATATTTTGTTATGGG
    AATACAGGAGCAGGGAAGACGCATACTATGATAGGGAATAATAAACAACAAGGATTGATTTATAATGTGATTGGGGAGTT
    ATTAAAAGAATTGCACAATGGTAAAGGGAATGATGGGAGTAAAAATGGGAATGCTAAAGGAAATGATGATATGCGCATAA
    ATAATGATAAAGAATTTAATCATAATCGTATAAATGATGATATGCGCATAAACAATCAAACAAATGATAATGATGTTGGT
    ACTCATTCTCCATTTTTATCTATTTCTTATTTGGAAATTTATAATGAAAAGGTTTATGATTTACTTGATCCAAAAGAAGT
    TAATTTAAGGGAATCCAATGGAGTAATTCTAGTCCCAGGGTTATCTACTAAAAAGATTTTTAATTTAAAAGATTTTGATT
    CAGTTTTTAAAAAGGGATTAGAGAATAGAACAACAGGAGAAACCAAACTTAATCAATTTAGTAGCAGAAGTCATTCTATT
    TTAAGAATTCAAAGAGGAGATGTTAAACTTCATTTAATAGATTTAGCTGGATCTGAAAATAATAGAAAAACAGGGAATGA
    AGGTGTTAGATTAACAGAATCAAGTAATATTAATAGAAGTTTATTTGTATTAGCTAAAGTAGTAAATTCTATTATTAATA
    AAGAAATAAGGATTCCTTATAGAGATAGTAAACTTACTAGATTATTACAAGACTCATTAGGAGGGAATAGTATTTGTTGT
    ATAATTGCTAATATAAATGATGATGAGAGTTGTATAGGAGATACGATAAATACATTGATGTTTGCCACGAAATCAAAAAA
    GATAATAAATAAAAGTGGGAATAAAAATGAAATTGGGAAGGTGGGTGATGTGAAGATGGGTGATGGTAGGGTAGTAGGAG
    GGAATAAGATGGATAATAAGAGAGCCATGGAATTTGAGGAGGCAGGCAAACTAAAAGAAGCCCTGGATGATTACAAAACA
    ATACAAAAATTTAATGAAAGTCAATTTGTGGAATCTAAAATAGAAAATTTAATTAATCAATTAAAAAATAATAAAAAGAA
    AGTTAAA

    Transcriptome
    ATGTCAAAAGACCAAAAACATTTTCCTGTTAAAGCTTTAATCCGAATAAGACCTGGTAATAATTTCCTTGAGTATACAGA
    TAAAATAGTAAAAATAGAAAAAGAAAATGGTATTGTTTCTGAATTCCATTTTGATAAAGTTTTGGGTCCTAATGCCACTC
    AAAACCAGGTCTTTAAAAGCATAAAAGAAGAATTAATTCGGTTTAGAGAAGGGTATAATACTACAATATTTTGTTATGGG
    AATACAGGAGCAGGGAAGACGCATACTATGATAGGGAATAATAAACAACAAGGATTGATTTATAATGTGATTGGGGAGTT
    ATTAAAAGAATTGCACAATGGTAAAGGGAATGATGGGAGTAAAAATGGGAATGCTAAAGGAAATGATGATATGCGCATAA
    ATAATGATAAAGAATTTAATCATAATCGTATAAATGATGATATGCGCATAAACAATCAAACAAATGATAATGATGTTGGT
    ACTCATTCTCCATTTTTATCTATTTCTTATTTGGAAATTTATAATGAAAAGGTTTATGATTTACTTGATCCAAAAGAAGT
    TAATTTAAGGGAATCCAATGGAGTAATTCTAGTCCCAGGGTTATCTACTAAAAAGATTTTTAATTTAAAAGATTTTGATT
    CAGTTTTTAAAAAGGGATTAGAGAATAGAACAACAGGAGAAACCAAACTTAATCAATTTAGTAGCAGAAGTCATTCTATT
    TTAAGAATTCAAAGAGGAGATGTTAAACTTCATTTAATAGATTTAGCTGGATCTGAAAATAATAGAAAAACAGGGAATGA
    AGGTGTTAGATTAACAGAATCAAGTAATATTAATAGAAGTTTATTTGTATTAGCTAAAGTAGTAAATTCTATTATTAATA
    AAGAAATAAGGATTCCTTATAGAGATAGTAAACTTACTAGATTATTACAAGACTCATTAGGAGGGAATAGTATTTGTTGT
    ATAATTGCTAATATAAATGATGATGAGAGTTGTATAGGAGATACGATAAATACATTGATGTTTGCCACGAAATCAAAAAA
    GATAATAAATAAAAGTGGGAATAAAAATGAAATTGGGAAGGTGGGTGATGTGAAGATGGGTGATGGTAGGGTAGTAGGAG
    GGAATAAGATGGATAATAAGAGAGCCATGGAATTTGAGGAGGCAGGCAAACTAAAAGAAGCCCTGGATGATTACAAAACA
    ATACAAAAATTTAATGAAAGTCAATTTGTGGAATCTAAAATAGAAAATTTAATTAATCAATTAAAAAATAATAAAAAGAA
    AGTTAAA