Information
Organism Papilio xuthus
Gene ID PxuthusGene0002851
Scaffold scaffold2399
Position 317..1054 [Map]
Strand -
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MNDFEKFFDKLKLEMSQQMSKQTNDIISQIDDKINPIILELKELKLENQNLKGKIENLEKHTRRNNIIIHGMKETENTIP
    DLMEKTIEKIKKELNIPIADKDIDNIYRIGKINKDNEKIRPILVTFVNGWMKNKVMMNKNKFKDIYVSDDYPKEVIARRK
    ELQTRLIEERNKGNFAVIKYDKLIIREGNNGKEKRKRETSSSPKTETQPRKQYVTSKANRINAFDVMRSRSNSLSSFTHT
    MEQNL

    CDS
    ATGAACGACTTCGAAAAATTTTTTGACAAACTAAAATTAGAAATGTCACAGCAAATGTCTAAACAAACAAACGATATAAT
    CTCCCAAATAGACGATAAAATTAACCCAATAATATTGGAATTAAAAGAATTAAAATTAGAAAATCAGAACTTGAAAGGAA
    AAATCGAGAATTTAGAAAAACATACGAGAAGAAATAACATTATAATACACGGCATGAAGGAAACTGAAAATACGATACCA
    GATCTAATGGAAAAAACTATAGAAAAAATTAAAAAAGAGCTCAATATACCTATAGCTGACAAGGACATTGACAACATTTA
    TCGAATCGGCAAAATTAATAAGGATAATGAAAAAATAAGACCTATATTAGTAACATTTGTCAATGGTTGGATGAAAAATA
    AAGTTATGATGAATAAAAATAAATTTAAAGATATATATGTTTCTGATGATTATCCCAAGGAAGTCATAGCAAGGAGGAAA
    GAACTGCAGACAAGATTAATAGAAGAAAGGAATAAAGGCAACTTTGCAGTGATTAAATATGATAAATTAATTATTAGAGA
    AGGAAACAATGGAAAAGAAAAGAGGAAACGAGAAACATCTTCATCTCCAAAAACAGAAACCCAGCCGAGAAAACAGTATG
    TTACTTCGAAAGCGAATAGAATAAATGCCTTCGACGTCATGAGATCTAGGAGTAATTCCCTGTCTTCATTCACCCATACA
    ATGGAACAAAACTTATAG

    Transcriptome
    ATGAACGACTTCGAAAAATTTTTTGACAAACTAAAATTAGAAATGTCACAGCAAATGTCTAAACAAACAAACGATATAAT
    CTCCCAAATAGACGATAAAATTAACCCAATAATATTGGAATTAAAAGAATTAAAATTAGAAAATCAGAACTTGAAAGGAA
    AAATCGAGAATTTAGAAAAACATACGAGAAGAAATAACATTATAATACACGGCATGAAGGAAACTGAAAATACGATACCA
    GATCTAATGGAAAAAACTATAGAAAAAATTAAAAAAGAGCTCAATATACCTATAGCTGACAAGGACATTGACAACATTTA
    TCGAATCGGCAAAATTAATAAGGATAATGAAAAAATAAGACCTATATTAGTAACATTTGTCAATGGTTGGATGAAAAATA
    AAGTTATGATGAATAAAAATAAATTTAAAGATATATATGTTTCTGATGATTATCCCAAGGAAGTCATAGCAAGGAGGAAA
    GAACTGCAGACAAGATTAATAGAAGAAAGGAATAAAGGCAACTTTGCAGTGATTAAATATGATAAATTAATTATTAGAGA
    AGGAAACAATGGAAAAGAAAAGAGGAAACGAGAAACATCTTCATCTCCAAAAACAGAAACCCAGCCGAGAAAACAGTATG
    TTACTTCGAAAGCGAATAGAATAAATGCCTTCGACGTCATGAGATCTAGGAGTAATTCCCTGTCTTCATTCACCCATACA
    ATGGAACAAAACTTATAG