Information
Organism Papilio xuthus
Gene ID PxuthusGene0000286
Scaffold scaffold1415
Position 262..956 [Map]
Strand -
Gene symbol/function B7FG61_MEDTR Putative uncharacterized protein (Fragment)
Ortholog in PapilioBase PpolytesGene0010751
Ortholog in silkworm BMgn016890
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MNSLGVWTLAIILYQTVACAVVSWLTLSCRLAPSAGELAELTLLKLVYLYEPRACAAPALYNYTVRSAAGTPVAALVWPA
    HSPPAAAFRR

    CDS
    ATGAATTCTCTAGGGGTTTGGACTTTAGCAATAATTTTGTATCAGACGGTAGCGTGCGCGGTGGTGAGCTGGCTTACGCT
    GAGCTGCCGACTGGCGCCGAGCGCGGGCGAGCTGGCCGAGCTGACGCTGCTCAAGCTGGTATACCTGTACGAACCGCGCG
    CCTGCGCCGCGCCCGCGCTCTACAACTACACAGTGCGCTCCGCCGCCGGCACCCCGGTCGCCGCGCTCGTCTGGCCCGCG
    CACAGTCCGCCCGCCGCCGCCTTCCGCAGGTGA

    Transcriptome
    CATACTCCGCTAGCCGTCGGCAAACGTGCCGCGGCCCTCTTGAACTGTCCAATACTCAGTTATCGCAGGAGGAAGGCCGC
    GGACTGTCACAGCATTCCCCAATTTATCTCTAATTTGAACAAATTAAAATCAAAAGCGATCTACTGCTTTAAAATGAATT
    CTCTAGGGGTTTGGACTTTAGCAATAATTTTGTATCAGACGGTAGCGTGCGCGGTGGTGAGCTGGCTTACGCTGAGCTGC
    CGACTGGCGCCGAGCGCGGGCGAGCTGGCCGAGCTGACGCTGCTCAAGCTGGTATACCTGTACGAACCGCGCGCCTGCGC
    CGCGCCCGCGCTCTACAACTACACAGTGCGCTCCGCCGCCGGCACCCCGGTCGCCGCGCTCGTCTGGCCCGCGCACAGTC
    CGCCCGCCGCCGCCTTCCGCAGGTGA