Information
Organism Papilio xuthus
Gene ID PxuthusGene0000019
Scaffold scaffold1147
Position 2..1077 [Map]
Strand +
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MLALNEMSRQNSVANEPSFTLETSQKLANLSATDALTCDANQLEESGVFGEAPSLLAHLRDAGLSALSDHILLEFKATIR
    EYKKLKWHAMLMVEEMGLSVSGALCGP

    CDS
    ATGTTGGCTCTCAACGAAATGTCACGTCAGAATTCTGTCGCGAACGAACCATCGTTTACCCTTGAGACGTCTCAAAAGTT
    GGCAAACCTGTCAGCGACGGATGCGCTGACGTGCGACGCGAACCAGTTGGAGGAGTCCGGCGTGTTCGGGGAGGCGCCGA
    GCTTGTTGGCGCACTTGCGCGACGCCGGCCTCTCGGCGCTCTCTGACCACATACTGCTCGAGTTCAAGGCCACCATACGC
    GAGTATAAGAAGCTAAAATGGCACGCGATGCTGATGGTGGAGGAGATGGGTCTGAGCGTGTCGGGCGCGCTGTGCGGGCC
    G

    Transcriptome
    AAATGTTGGCTCTCAACGAAATGTCACGTCAGAATTCTGTCGCGAACGAACCATCGTTTACCCTTGAGACGTCTCAAAAG
    TTGGCAAACCTGTCAGCGACGGATGCGCTGACGTGCGACGCGAACCAGTTGGAGGAGTCCGGCGTGTTCGGGGAGGCGCC
    GAGCTTGTTGGCGCACTTGCGCGACGCCGGCCTCTCGGCGCTCTCTGACCACATACTGCTCGAGTTCAAGGCCACCATAC
    GCGAGTATAAGAAGCTAAAATGGCACGCGATGCTGATGGTGGAGGAGATGGGTCTGAGCGTGTCGGGCGCGCTGTGCGGG
    CCGC