Information
Organism Papilio xuthus
Gene ID PxuthusGene0000008
Scaffold scaffold1023
Position 492..1402 [Map]
Strand +
Gene symbol/function
Ortholog in PapilioBase
Ortholog in silkworm
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MVCDREGKFAERLMAASVRLLPGPLAALAHDAAPPGPAALAAVARHKRLFLDTPDPGLRELCCGRGASGVSALACRGVWC
    ALGGAGAAEARGWWGALGAREARAVRRLVTLCVAPLLRDRHLAELRARAHTLPDAEVAVLSDGSARCRLQLDERTLELSV
    QFAEAHPLVPPRVCSAAAAALLRPAAADAHWLTVYLAYQNGSLYNTFKMWVRAMNGRIESTRQCCVCYYRLHPTTGRLPA
    ALCPQCRNKFH

    CDS
    ATGGTATGCGATAGGGAGGGCAAGTTCGCGGAGCGGCTGATGGCGGCCAGCGTGCGCCTGCTGCCGGGCCCGCTGGCCGC
    GCTGGCGCACGACGCCGCGCCGCCGGGACCCGCCGCGCTCGCCGCCGTCGCCCGCCACAAGCGCCTCTTCCTCGACACGC
    CCGACCCCGGCCTCAGAGAGCTGTGCTGCGGGCGCGGTGCGAGCGGTGTGAGCGCGCTGGCGTGCCGCGGGGTGTGGTGC
    GCGCTGGGGGGCGCGGGCGCGGCCGAGGCGCGCGGGTGGTGGGGCGCGCTGGGGGCGCGGGAGGCGCGCGCGGTGCGCCG
    GCTGGTGACGCTGTGCGTGGCGCCGCTGTTGCGCGACCGGCACCTGGCGGAGTTGCGCGCGCGCGCCCACACGCTGCCCG
    ACGCGGAGGTGGCGGTGCTGAGCGACGGCTCGGCGCGCTGCCGGCTGCAGCTGGACGAGCGCACGCTGGAGCTGAGCGTG
    CAGTTCGCGGAGGCGCACCCGCTGGTGCCGCCGCGAGTCTGCTCCGCCGCCGCCGCCGCGCTGCTGCGCCCCGCCGCCGC
    CGACGCGCACTGGCTCACCGTCTACCTCGCCTACCAGAACGGGTCGCTGTACAACACGTTCAAGATGTGGGTGCGCGCGA
    TGAACGGCCGCATCGAGAGCACGCGCCAGTGCTGCGTCTGCTACTACCGCCTGCACCCCACCACCGGCCGCCTGCCCGCC
    GCGCTCTGCCCGCAGTGCCGCAACAAGTTCCAC

    Transcriptome
    ATGGTATGCGATAGGGAGGGCAAGTTCGCGGAGCGGCTGATGGCGGCCAGCGTGCGCCTGCTGCCGGGCCCGCTGGCCGC
    GCTGGCGCACGACGCCGCGCCGCCGGGACCCGCCGCGCTCGCCGCCGTCGCCCGCCACAAGCGCCTCTTCCTCGACACGC
    CCGACCCCGGCCTCAGAGAGCTGTGCTGCGGGCGCGGTGCGAGCGGTGTGAGCGCGCTGGCGTGCCGCGGGGTGTGGTGC
    GCGCTGGGGGGCGCGGGCGCGGCCGAGGCGCGCGGGTGGTGGGGCGCGCTGGGGGCGCGGGAGGCGCGCGCGGTGCGCCG
    GCTGGTGACGCTGTGCGTGGCGCCGCTGTTGCGCGACCGGCACCTGGCGGAGTTGCGCGCGCGCGCCCACACGCTGCCCG
    ACGCGGAGGTGGCGGTGCTGAGCGACGGCTCGGCGCGCTGCCGGCTGCAGCTGGACGAGCGCACGCTGGAGCTGAGCGTG
    CAGTTCGCGGAGGCGCACCCGCTGGTGCCGCCGCGAGTCTGCTCCGCCGCCGCCGCCGCGCTGCTGCGCCCCGCCGCCGC
    CGACGCGCACTGGCTCACCGTCTACCTCGCCTACCAGAACGGGTCGCTGTACAACACGTTCAAGATGTGGGTGCGCGCGA
    TGAACGGCCGCATCGAGAGCACGCGCCAGTGCTGCGTCTGCTACTACCGCCTGCACCCCACCACCGGCCGCCTGCCCGCC
    GCGCTCTGCCCGCAGTGCCGCAACAAGTTCCAC