Information
Organism Papilio polytes
Gene ID PpolytesGene0008542
Scaffold scaffold3534
Position 41745..42761 [Map]
Strand -
Gene symbol/function D2A134_TRICA Putative uncharacterized protein GLEAN_08318
Ortholog in PapilioBase PxuthusGene0012351
Ortholog in silkworm BMgn009999
Sequence
  • Peptide
  • CDS
  • Transcriptome

  • Peptide
    MALYEGIALIQEKQAVVLDLGTDYTKFGFTGEPAPRCIVRSEFWCEAERRYKRLHDYRTPQELYDNLVHMLHLLYFRHVL
    VNPKERRVVVVESLLTPTIFRETLAKVLFIHYEVLRRIHFNK

    CDS
    ATGGCGCTCTACGAGGGCATTGCGCTTATTCAAGAAAAACAAGCAGTTGTCTTGGATCTGGGCACCGATTACACCAAGTT
    CGGGTTCACGGGCGAGCCGGCCCCGCGCTGCATCGTGCGCTCCGAGTTCTGGTGCGAGGCGGAGCGCCGATACAAGCGGC
    TGCACGACTACCGCACGCCACAGGAGCTCTATGACAACCTTGTCCATATGCTGCATTTGTTGTATTTTAGACATGTGCTG
    GTGAACCCGAAGGAGCGGCGCGTGGTGGTGGTGGAGTCCCTGCTCACGCCCACAATCTTCCGAGAGACTCTCGCTAAAGT
    TCTCTTTATACATTATGAGGTATTGAGGAGAATCCATTTTAATAAATAA

    Transcriptome
    CAGCACAGCATGCGTCATTGCATTGTCAAATGTCGACGATGTTGTAGTAGTTACAATAATAACAAAGTTTTACAAAAAAC
    ATTATCTTCTTGGTAGTTTACATTTCTAACACGAAATATCTGCTAATTTTTGGAAAAAGTTTAGTATTAGCGACAAAACC
    ATGGCGCTCTACGAGGGCATTGCGCTTATTCAAGAAAAACAAGCAGTTGTCTTGGATCTGGGCACCGATTACACCAAGTT
    CGGGTTCACGGGCGAGCCGGCCCCGCGCTGCATCGTGCGCTCCGAGTTCTGGTGCGAGGCGGAGCGCCGATACAAGCGGC
    TGCACGACTACCGCACGCCACAGGAGCTCTATGACAACCTTGTCCATATGCTGCATTTGTTGTATTTTAGACATGTGCTG
    GTGAACCCGAAGGAGCGGCGCGTGGTGGTGGTGGAGTCCCTGCTCACGCCCACAATCTTCCGAGAGACTCTCGCTAAAGT
    TCTCTTTATACATTATGAGGTATTGAGGAGAATCCATTTTAATAAATAAATATTCACCGTCCTGAGAAGAAGTATTACCA
    AATATGTGCATGTGGACCTCAAGTGAGAAACGACATCCATATCATTCCATCGGTTGCTTTATCAAGATGTGGAACGGTGG
    CTAGTGTAGTGAGGGGCATTTGCGCAGGTGTCGN